
LL-37 1mg Spray is a research-grade synthetic cationic antimicrobial peptide (cathelicidin) formulated in a pre-metered liquid vehicle for non-invasive laboratory research. As the sole human cathelicidin-derived peptide, LL-37 (sequence: Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser) is studied for its capacity to disrupt bacterial membranes, neutralize lipopolysaccharide (LPS) endotoxins, and recruit immune cells. Formulated as a stabilized solution, each bottle contains 1mg total active peptide, analytically verified by HPLC to support reproducible scientific investigations.
HPLC certified
Independent analysis
Highest standard
Full traceability
LL-37 1mg Spray is a synthetic 37-amino-acid peptide solution designed to evaluate non-invasive mucosal transport kinetics and innate immune signaling pathways. Characterized by its amphipathic alpha-helical structure and strong positive net charge (+6), LL-37 interacts directly with negatively charged lipid membranes, providing a valuable model for studying membrane permeabilization, immune recruitment, and endotoxin binding kinetics. Unlike standard lyophilized powders that require reconstitution, this spray format provides a concentration-verified, pre-dissolved liquid format suitable for direct laboratory dispensing.
Researchers continue to investigate LL-37 across major areas of immunology and microbiology, including bacterial membrane disruption, LPS-induced cytokine suppression, endothelial cell vascularization (angiogenesis), and epithelial wound healing. The intranasal spray formulation is of high scientific interest because it allows researchers to study epithelial membrane transport kinetics of cationic peptides and local innate immune responses in mucosal barriers without invasive administration. Formulated with high-purity research-grade materials, LL-37 1mg Spray is a specialized molecular tool for laboratories examining antimicrobial peptide dynamics under controlled conditions.
LL-37 1mg Spray is a research-grade synthetic peptide solution developed for laboratory investigations involving innate immunity, cell membrane biophysics, and non-invasive delivery methods. Chemically classified as the active functional fragment of the human cathelicidin antimicrobial peptide (CAMP), it comprises 37 amino acid residues starting with two N-terminal Leucines (sequence: [LL-37, 37 aa]). As a highly cationic (+6 net charge) and amphipathic peptide, LL-37 is studied for its ability to target and disrupt anionic cell membranes, regulate inflammatory signaling, and stimulate vascular cell migration.
From a molecular research perspective, LL-37 Spray provides a valuable model for investigating the transport kinetics of cationic amphipathic peptides across epithelial cell layers. Standard peptide studies frequently depend on parenteral routes; however, liquid spray preparations enable researchers to evaluate how amphipathic peptides cross mucosal membranes, interact with tight junctions, and engage localized cellular receptors. This spray format is particularly suited for research involving nasal mucosal cell lines.
Current laboratory investigations examine LL-37's interaction with lipid bilayers. In membrane biophysics models, exposure to the peptide results in binding to negatively charged bacterial membranes, leading to membrane thinning and disruption via the toroidal pore or carpet model. These membrane interactions are studied to characterize the physical mechanisms of peptide-mediated cell lysis, selective toxicity, and antimicrobial defense networks under controlled in vitro conditions.
Beyond direct cell membrane disruption, researchers use LL-37 to explore endotoxin neutralization and immunomodulation. Studies evaluate how the cationic peptide directly binds to anionic lipopolysaccharides (LPS), preventing LPS from interacting with Toll-like receptor 4 (TLR4) complexes on macrophages. This pathway is studied to analyze the suppression of pro-inflammatory cytokines and the modulation of dendritic cell activation in experimental inflammatory models.
In neurobiology and central nervous system (CNS) research, the intranasal spray format provides an optimized experimental model for studying direct blood-brain barrier (BBB) bypass. Researchers evaluate whether mucosal delivery via olfactory or trigeminal nerve pathways facilitates direct transport of cationic peptides to hypothalamic and brainstem structures. This allows the study of central immune responses, glial cell activation, and localized cytokine regulation without systemic variables.
Each bottle of LL-37 1mg Spray is manufactured using solid-phase peptide synthesis (SPPS), followed by purification and solution formulation steps. The resulting active peptide is dissolved in a stabilized, buffered aqueous solution calibrated to ensure exact concentration per metered spray activation. Quality control protocols include reverse-phase high-performance liquid chromatography (HPLC) for purity verification and liquid chromatography-mass spectrometry (LC-MS) for molecular identity confirmation.
To preserve the stability of the peptide in solution, LL-37 Spray should be stored under refrigeration (2°C to 8°C) and protected from light. Because amphipathic peptides can undergo aggregation or peptide cleavage in aqueous environments over time, maintaining refrigerated storage and minimizing atmospheric exposure is critical to preserving peptide integrity. Proper handling supports consistent concentration and analytical reproducibility across laboratory protocols.
Scientific interest in LL-37 continues to expand as researchers seek to characterize its stability, receptor interactions, and transport kinetics. Nevertheless, many aspects of its cellular signaling and epithelial transport remain active areas of scientific inquiry. Ongoing studies continue to refine the understanding of cathelicidin-derived peptides in biological systems. For this reason, LL-37 1mg Spray should be regarded as an investigational compound whose primary value lies in advancing scientific knowledge of innate immune receptor biology.
LL-37 1mg Spray is supplied exclusively for laboratory research and analytical applications. It is intended for Research Use Only (RUO) and is not approved for human consumption, therapeutic use, veterinary use, or diagnostic purposes.
Be the first to share your experience with this product and help other researchers!

Retatrutide reconstitution reference with 10mg, 20mg, 30mg and 60mg mg-to-mL math, BAC water volume options, U-100 unit conversion and COA checks.

KPV nasal spray research: the 342 Da α-MSH tripeptide, why molecular weight favors nasal absorption, and why no published intranasal KPV study exists.

What Ozempic face is, why rapid GLP-1 weight loss thins the facial fat compartments, and what published GHK-Cu collagen research does and does not show.
(faqs)